IFSC code
SBIN0021130
State Bank of India, Mangalagiri branch
Guntur district, Andhra Pradesh
- Bank
- State Bank of India
- Branch
- Mangalagiri
- IFSC
SBIN0021130(bank code SBIN, branch code 021130)- MICR
520002144- Address
- N82671CVRCMPLEXBHARGAVPETANEARFLWERMKTMANGALAGIRIGUNTURIST
- Centre / city
- Guntur
- Phone
- +918671274546 (as listed by the bank)
- Payments
- NEFT · RTGS · IMPS · UPI
- Location
- The RBI list gives no map position, so no distances are shown.
Source: Reserve Bank of India IFSC list, release of 1 Sept 2026 (Bank branches: Reserve Bank of India IFSC lists, via github.com/razorpay/ifsc, Public domain). Last seen in the list 24 Oct 2026.
Check the IFSC with your bank or on your cheque book before you send money. Banks merge and renumber branches, and a transfer to a wrong code can fail or be delayed. VoiceOfVillage is not a bank and is not affiliated with State Bank of India.
Other State Bank of India branches in Guntur district
- A P H B Colony Guntur ·
SBIN0021263 - A P High Court, Amaravati ·
SBIN0061328 - A.p. Secretariat, Velagapudi ·
SBIN0018884 - Abburu ·
SBIN0021509 - Admn Office, Guntur ·
SBIN0015312 - Aiims, Mangalagiri ·
SBIN0061485 - Amcc- Guntur ·
SBIN0065172 - Angalakudurukopalle ·
SBIN0021793· Tenali - Apcrda Amaravati ·
SBIN0065247 - Arumbaka ·
SBIN0006517 - Arundelpet ·
SBIN0001014 - Athota ·
SBIN0011995 - Atmakur ·
SBIN0018828 - Autonagar Guntur ·
SBIN0021231 - Bapatla ·
SBIN0021155 - Bapatla ·
SBIN0000815 - Bhattiprolu ·
SBIN0002697 - Boyapalem ·
SBIN0021286 - Brodipet ·
SBIN0011095 - Burripalem ·
SBIN0021211 - Cac, Tenali ·
SBIN0061430· Tenali - Chavali ·
SBIN0020441 - Chilakaluripet ·
SBIN0020507 - Chinaravur ·
SBIN0014823